CDS

Accession Number TCMCG014C17154
gbkey CDS
Protein Id GAY48844.1
Location complement(join(198102..198198,198830..198856,199039..199121))
Organism Citrus unshiu
locus_tag CUMW_114800

Protein

Length 68aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJDB5882, BioSample:SAMD00083908, Sequence Read Archive:DRR142810, DRR142811, DRR142812, DRR142818,, DRR142819, DRR142820, DRR142821, DRR142822
db_source BDQV01000048.1
Definition hypothetical protein CUMW_114800 [Citrus unshiu]
Locus_tag CUMW_114800

EGGNOG-MAPPER Annotation

COG_category C
Description Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
KEGG_TC 3.D.1.6
KEGG_Module M00146        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko03029        [VIEW IN KEGG]
KEGG_ko ko:K11352        [VIEW IN KEGG]
ko:K18160        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00190        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko04714        [VIEW IN KEGG]
ko04723        [VIEW IN KEGG]
ko04932        [VIEW IN KEGG]
ko05010        [VIEW IN KEGG]
ko05012        [VIEW IN KEGG]
ko05016        [VIEW IN KEGG]
map00190        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map04714        [VIEW IN KEGG]
map04723        [VIEW IN KEGG]
map04932        [VIEW IN KEGG]
map05010        [VIEW IN KEGG]
map05012        [VIEW IN KEGG]
map05016        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0005740        [VIEW IN EMBL-EBI]
GO:0005743        [VIEW IN EMBL-EBI]
GO:0005746        [VIEW IN EMBL-EBI]
GO:0005747        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006979        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009719        [VIEW IN EMBL-EBI]
GO:0009725        [VIEW IN EMBL-EBI]
GO:0009735        [VIEW IN EMBL-EBI]
GO:0010033        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0019866        [VIEW IN EMBL-EBI]
GO:0030964        [VIEW IN EMBL-EBI]
GO:0031090        [VIEW IN EMBL-EBI]
GO:0031966        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0042221        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043169        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044429        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044455        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045271        [VIEW IN EMBL-EBI]
GO:0046872        [VIEW IN EMBL-EBI]
GO:0046914        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0050897        [VIEW IN EMBL-EBI]
GO:0070469        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:0098798        [VIEW IN EMBL-EBI]
GO:0098800        [VIEW IN EMBL-EBI]
GO:0098803        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1990204        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCTATGAAGAGCGCGTTGAAGTCGATCAGAGAGAGAGGTCTCGGTTCCTTCCTTCGCGAGATCAAGGAAGAAGGCTTCCTGAGGGCACTTCTTGATGGAAATCTCATGCAAACCAAGTTACATAATAGAGGGGCAACGCTTGTTGGAGTTGATAAATTTGGTAACAAGTATTATCAGAAACTTGACGAGCAATTTGGTCAGTAA
Protein:  
MAMKSALKSIRERGLGSFLREIKEEGFLRALLDGNLMQTKLHNRGATLVGVDKFGNKYYQKLDEQFGQ